Lineage for d1ogym2 (1ogy M:12-681)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140578Protein Periplasmic nitrate reductase alpha chain [53717] (2 species)
  7. 2140585Species Rhodobacter sphaeroides [TaxId:1063] [102672] (1 PDB entry)
  8. 2140592Domain d1ogym2: 1ogy M:12-681 [92971]
    Other proteins in same PDB: d1ogya1, d1ogyb_, d1ogyc1, d1ogyd_, d1ogye1, d1ogyf_, d1ogyg1, d1ogyh_, d1ogyi1, d1ogyj_, d1ogyk1, d1ogyl_, d1ogym1, d1ogyn_, d1ogyo1, d1ogyp_
    complexed with hec, mgd, mo, sf4

Details for d1ogym2

PDB Entry: 1ogy (more details), 3.2 Å

PDB Description: crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides
PDB Compounds: (M:) periplasmic nitrate reductase

SCOPe Domain Sequences for d1ogym2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogym2 c.81.1.1 (M:12-681) Periplasmic nitrate reductase alpha chain {Rhodobacter sphaeroides [TaxId: 1063]}
irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
gvpyeppaes

SCOPe Domain Coordinates for d1ogym2:

Click to download the PDB-style file with coordinates for d1ogym2.
(The format of our PDB-style files is described here.)

Timeline for d1ogym2: