SCOPe 2.08: Domain d1ogyk1: 1ogy K:682-801

Lineage for d1ogyk1 (1ogy K:682-801)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [101827] (1 PDB entry)

8. Domain d1ogyk1: 1ogy K:682-801 [92967]
   Other proteins in same PDB: d1ogya2, d1ogyb_, d1ogyc2, d1ogyd_, d1ogye2, d1ogyf_, d1ogyg2, d1ogyh_, d1ogyi2, d1ogyj_, d1ogyk2, d1ogyl_, d1ogym2, d1ogyn_, d1ogyo2, d1ogyp_
   complexed with hec, mgd, mo, sf4

Details for d1ogyk1

PDB Entry: 1ogy, 3.2 Å

PDB Description: crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides

PDB Compounds: (K:) periplasmic nitrate reductase

SCOPe Domain Sequences for d1ogyk1:

Sequence; same for both SEQRES and ATOM records:

>d1ogyk1 b.52.2.2 (K:682-801) Periplasmic nitrate reductase alpha chain, NapA {Rhodobacter sphaeroides [TaxId: 1063]}
pdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrglnrgsevrvi
srrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtdfkkcavkiea

Timeline for d1ogyk1:

• d1ogyk1 first appeared in SCOP 1.67
  
• d1ogyk1 appears in SCOPe 2.07