Lineage for d1ogyi1 (1ogy I:682-801)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467226Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)
  7. 467229Species Rhodobacter sphaeroides [TaxId:1063] [101827] (1 PDB entry)
  8. 467234Domain d1ogyi1: 1ogy I:682-801 [92964]
    Other proteins in same PDB: d1ogya2, d1ogyb_, d1ogyc2, d1ogyd_, d1ogye2, d1ogyf_, d1ogyg2, d1ogyh_, d1ogyi2, d1ogyj_, d1ogyk2, d1ogyl_, d1ogym2, d1ogyn_, d1ogyo2, d1ogyp_

Details for d1ogyi1

PDB Entry: 1ogy (more details), 3.2 Å

PDB Description: crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides

SCOP Domain Sequences for d1ogyi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogyi1 b.52.2.2 (I:682-801) Periplasmic nitrate reductase alpha chain, NapA {Rhodobacter sphaeroides}
pdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrglnrgsevrvi
srrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtdfkkcavkiea

SCOP Domain Coordinates for d1ogyi1:

Click to download the PDB-style file with coordinates for d1ogyi1.
(The format of our PDB-style files is described here.)

Timeline for d1ogyi1: