Lineage for d1ogvh1 (1ogv H:36-247)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316165Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1316166Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1316167Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1316168Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1316169Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
    Uniprot P11846
  8. 1316195Domain d1ogvh1: 1ogv H:36-247 [92948]
    Other proteins in same PDB: d1ogvh2, d1ogvl_, d1ogvm_
    complexed with bcl, bph, cdl, cl, fe2, u10

Details for d1ogvh1

PDB Entry: 1ogv (more details), 2.35 Å

PDB Description: lipidic cubic phase crystal structure of the photosynthetic reaction centre from rhodobacter sphaeroides
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1ogvh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogvh1 b.41.1.1 (H:36-247) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapk

SCOPe Domain Coordinates for d1ogvh1:

Click to download the PDB-style file with coordinates for d1ogvh1.
(The format of our PDB-style files is described here.)

Timeline for d1ogvh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogvh2