SCOPe 2.05: Domain d1ogub1: 1ogu B:178-309

Lineage for d1ogub1 (1ogu B:178-309)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
   Uniprot P20248 175-432

8. Domain d1ogub1: 1ogu B:178-309 [92943]
   Other proteins in same PDB: d1ogua_, d1oguc_
   complexed with sgm, st8

Details for d1ogub1

PDB Entry: 1ogu, 2.6 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 2-arylamino-4-cyclohexylmethyl-5-nitroso-6-aminopyrimidine inhibitor

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1ogub1:

Sequence, based on SEQRES records:

>d1ogub1 a.74.1.1 (B:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
vlkvltfdlaap

Sequence, based on observed residues (ATOM records):

>d1ogub1 a.74.1.1 (B:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehlvl
kvltfdlaap

Timeline for d1ogub1:

• d1ogub1 first appeared in SCOP 1.67
  
• d1ogub1 appears in SCOPe 2.04
  
• d1ogub1 appears in SCOPe 2.06
  
• d1ogub1 appears in the current release, SCOPe 2.08