Lineage for d1ogua_ (1ogu A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672328Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1672329Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries)
    Uniprot P24941
  8. 1672689Domain d1ogua_: 1ogu A: [92942]
    Other proteins in same PDB: d1ogub1, d1ogub2, d1ogud1, d1ogud2
    complex with cyclin
    complexed with sgm, st8

Details for d1ogua_

PDB Entry: 1ogu (more details), 2.6 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 2-arylamino-4-cyclohexylmethyl-5-nitroso-6-aminopyrimidine inhibitor
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d1ogua_:

Sequence, based on SEQRES records: (download)

>d1ogua_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d1ogua_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d1ogua_:

Click to download the PDB-style file with coordinates for d1ogua_.
(The format of our PDB-style files is described here.)

Timeline for d1ogua_: