SCOP 1.73: Domain d1ogpd2: 1ogp D:2-262

Lineage for d1ogpd2 (1ogp D:2-262)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif

4. Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (1 family)

5. Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins)
   Pfam PF00174

6. Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [103363] (1 PDB entry)

8. Domain d1ogpd2: 1ogp D:2-262 [92934]
   Other proteins in same PDB: d1ogpa1, d1ogpb1, d1ogpc1, d1ogpd1, d1ogpe1, d1ogpf1

Details for d1ogpd2

PDB Entry: 1ogp, 2.6 Å

PDB Description: the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals

PDB Compounds: (D:) sulfite oxidase

SCOP Domain Sequences for d1ogpd2:

Sequence; same for both SEQRES and ATOM records:

>d1ogpd2 d.176.1.1 (D:2-262) Sulfite oxidase, middle catalytic domain {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
kmfppsvnwdninwssrrpqm

Timeline for d1ogpd2:

• d1ogpd2 first appeared in SCOP 1.67
  
• d1ogpd2 appears in SCOP 1.71
  
• d1ogpd2 appears in SCOP 1.75
  
• d1ogpd2 appears in the current release, SCOPe 2.08