Lineage for d1ogox2 (1ogo X:202-574)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380828Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 380829Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 380940Family b.80.1.10: Dextranase, catalytic domain [101954] (1 protein)
    this is a repeat family; one repeat unit is 1ogm X:388-409 found in domain
  6. 380941Protein Dextranase, catalytic domain [101955] (1 species)
  7. 380942Species Penicillium minioluteum [TaxId:28574] [101956] (2 PDB entries)
  8. 380944Domain d1ogox2: 1ogo X:202-574 [92926]
    Other proteins in same PDB: d1ogox1
    complexed with bgc, glc; mutant

Details for d1ogox2

PDB Entry: 1ogo (more details), 1.65 Å

PDB Description: dex49a from penicillium minioluteum complex with isomaltose

SCOP Domain Sequences for d1ogox2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogox2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum}
lpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgvywmnqdqsgnsgklgsnhirl
nsntywvylapgayvkgaieyftkqnfyatghgilsgenyvyqanagdnyiavksdstsl
rmwwhnnlgggqtwycvgptinappfntmdfngnsgissqisdykqvgafffqtdgpeiy
pnsvvhdvfwhvnddaikiyysgasvsratiwkchndpiiqmgwtsrdisgvtidtlnvi
htryiksetvvpsaiigaspfyasgmspdsrksismtvsnvvceglcpslfritplqnyk
nfvvknvafpdglqtnsigtgesiipaasgltmglaisawtiggqkvtmenfqanslgqf
nidgsywgewqis

SCOP Domain Coordinates for d1ogox2:

Click to download the PDB-style file with coordinates for d1ogox2.
(The format of our PDB-style files is described here.)

Timeline for d1ogox2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogox1