![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.133.1: Dextranase, N-terminal domain [101596] (1 family) ![]() |
![]() | Family b.133.1.1: Dextranase, N-terminal domain [101597] (1 protein) |
![]() | Protein Dextranase, N-terminal domain [101598] (1 species) |
![]() | Species Penicillium minioluteum [TaxId:28574] [101599] (2 PDB entries) |
![]() | Domain d1ogox1: 1ogo X:3-201 [92925] Other proteins in same PDB: d1ogox2 complexed with bgc, glc; mutant |
PDB Entry: 1ogo (more details), 1.65 Å
SCOP Domain Sequences for d1ogox1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogox1 b.133.1.1 (X:3-201) Dextranase, N-terminal domain {Penicillium minioluteum} ttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyesip rngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgssl gspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvtsg gsvvgveptnalvifaspf
Timeline for d1ogox1: