Lineage for d1ogmx2 (1ogm X:202-574)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470209Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 470210Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 470322Family b.80.1.10: Dextranase, catalytic domain [101954] (1 protein)
    this is a repeat family; one repeat unit is 1ogm X:388-409 found in domain
  6. 470323Protein Dextranase, catalytic domain [101955] (1 species)
  7. 470324Species Penicillium minioluteum [TaxId:28574] [101956] (2 PDB entries)
  8. 470325Domain d1ogmx2: 1ogm X:202-574 [92924]
    Other proteins in same PDB: d1ogmx1

Details for d1ogmx2

PDB Entry: 1ogm (more details), 1.8 Å

PDB Description: dex49a from penicillium minioluteum

SCOP Domain Sequences for d1ogmx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum}
lpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgvywmnqdqsgnsgklgsnhirl
nsntywvylapgayvkgaieyftkqnfyatghgilsgenyvyqanagdnyiavksdstsl
rmwwhnnlgggqtwycvgptinappfntmdfngnsgissqisdykqvgafffqtdgpeiy
pnsvvhdvfwhvnddaikiyysgasvsratiwkchndpiiqmgwtsrdisgvtidtlnvi
htryiksetvvpsaiigaspfyasgmspdsrksismtvsnvvceglcpslfritplqnyk
nfvvknvafpdglqtnsigtgesiipaasgltmglaisawtiggqkvtmenfqanslgqf
nidgsywgewqis

SCOP Domain Coordinates for d1ogmx2:

Click to download the PDB-style file with coordinates for d1ogmx2.
(The format of our PDB-style files is described here.)

Timeline for d1ogmx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogmx1