Lineage for d1ogmx1 (1ogm X:3-201)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383512Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 383513Superfamily b.133.1: Dextranase, N-terminal domain [101596] (1 family) (S)
  5. 383514Family b.133.1.1: Dextranase, N-terminal domain [101597] (1 protein)
  6. 383515Protein Dextranase, N-terminal domain [101598] (1 species)
  7. 383516Species Penicillium minioluteum [TaxId:28574] [101599] (2 PDB entries)
  8. 383517Domain d1ogmx1: 1ogm X:3-201 [92923]
    Other proteins in same PDB: d1ogmx2
    mutant

Details for d1ogmx1

PDB Entry: 1ogm (more details), 1.8 Å

PDB Description: dex49a from penicillium minioluteum

SCOP Domain Sequences for d1ogmx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogmx1 b.133.1.1 (X:3-201) Dextranase, N-terminal domain {Penicillium minioluteum}
ttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyesip
rngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgssl
gspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvtsg
gsvvgveptnalvifaspf

SCOP Domain Coordinates for d1ogmx1:

Click to download the PDB-style file with coordinates for d1ogmx1.
(The format of our PDB-style files is described here.)

Timeline for d1ogmx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogmx2