Lineage for d1ogla_ (1ogl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014645Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2014646Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2014647Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
    one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains
  6. 2014648Protein Type II deoxyuridine triphosphatase [101388] (2 species)
  7. 2014653Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries)
  8. 2014654Domain d1ogla_: 1ogl A: [92922]

Details for d1ogla_

PDB Entry: 1ogl (more details), 2.4 Å

PDB Description: the crystal structure of native trypanosoma cruzi dutpase
PDB Compounds: (A:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d1ogla_:

Sequence, based on SEQRES records: (download)

>d1ogla_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi [TaxId: 5693]}
rvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaq
tdmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasg
qrtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldf
nlvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylka
wekiacsvfdafgmpeeerrhaydwlksaa

Sequence, based on observed residues (ATOM records): (download)

>d1ogla_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi [TaxId: 5693]}
rvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaq
tdmhnvrieiadilhfslsgeiqkrtqdddvalkslkemgffcrppadellelmffplte
vasavatfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykeg
vyvkvregvednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhayd
wlksaa

SCOPe Domain Coordinates for d1ogla_:

Click to download the PDB-style file with coordinates for d1ogla_.
(The format of our PDB-style files is described here.)

Timeline for d1ogla_: