Lineage for d1ogkd_ (1ogk D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545973Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 545974Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (2 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 545975Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
    one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains
  6. 545976Protein Type II deoxyuridine triphosphatase [101388] (2 species)
  7. 545980Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries)
  8. 545984Domain d1ogkd_: 1ogk D: [92920]

Details for d1ogkd_

PDB Entry: 1ogk (more details), 2.85 Å

PDB Description: the crystal structure of trypanosoma cruzi dutpase in complex with dudp

SCOP Domain Sequences for d1ogkd_:

Sequence, based on SEQRES records: (download)

>d1ogkd_ a.204.1.1 (D:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi}
parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd
mhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasgqr
tnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldfnl
vgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylkawe
kiacsvfdafgmpeeerrhaydwlksaal

Sequence, based on observed residues (ATOM records): (download)

>d1ogkd_ a.204.1.1 (D:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi}
parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd
mhnvrieiadilhfslsgeiqkralkslkemgffcrppdellelmffpltevasavatfr
niiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregv
ednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaal

SCOP Domain Coordinates for d1ogkd_:

Click to download the PDB-style file with coordinates for d1ogkd_.
(The format of our PDB-style files is described here.)

Timeline for d1ogkd_: