Class a: All alpha proteins [46456] (290 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein) one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains |
Protein Type II deoxyuridine triphosphatase [101388] (2 species) |
Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries) |
Domain d1ogkd_: 1ogk D: [92920] complexed with dud |
PDB Entry: 1ogk (more details), 2.85 Å
SCOPe Domain Sequences for d1ogkd_:
Sequence, based on SEQRES records: (download)
>d1ogkd_ a.204.1.1 (D:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi [TaxId: 5693]} parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd mhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasgqr tnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldfnl vgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylkawe kiacsvfdafgmpeeerrhaydwlksaal
>d1ogkd_ a.204.1.1 (D:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi [TaxId: 5693]} parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd mhnvrieiadilhfslsgeiqkralkslkemgffcrppdellelmffpltevasavatfr niiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregv ednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaal
Timeline for d1ogkd_: