SCOPe 2.08: Domain d1ogkb_: 1ogk B:

Lineage for d1ogkb_ (1ogk B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
   one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains

6. Protein Type II deoxyuridine triphosphatase [101388] (2 species)

7. Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries)

8. Domain d1ogkb_: 1ogk B: [92919]
   complexed with dud

Details for d1ogkb_

PDB Entry: 1ogk, 2.85 Å

PDB Description: the crystal structure of trypanosoma cruzi dutpase in complex with dudp

PDB Compounds: (B:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d1ogkb_:

Sequence, based on SEQRES records:

>d1ogkb_ a.204.1.1 (B:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi [TaxId: 5693]}
parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd
mhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasgqr
tnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldfnl
vgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylkawe
kiacsvfdafgmpeeerrhaydwlksaal

Sequence, based on observed residues (ATOM records):

>d1ogkb_ a.204.1.1 (B:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi [TaxId: 5693]}
parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd
mhnvrieiadilhfslsgeiqkrdvalkslkemgffcrppdellelmffpltevasavat
frniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvre
gvednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaal

Timeline for d1ogkb_:

• d1ogkb_ first appeared in SCOP 1.67
  
• d1ogkb_ appears in SCOPe 2.07