![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (2 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein) one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains |
![]() | Protein Type II deoxyuridine triphosphatase [101388] (2 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries) |
![]() | Domain d1ogka_: 1ogk A: [92918] |
PDB Entry: 1ogk (more details), 2.85 Å
SCOP Domain Sequences for d1ogka_:
Sequence, based on SEQRES records: (download)
>d1ogka_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi} vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt dmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasgq rtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldfn lvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylkaw ekiacsvfdafgmpeeerrhaydwlksaald
>d1ogka_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi} vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt dmhnvrieiadilhfslsgeiqkrddvalkslkemgffcrppaddellelmffpltevas avatfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlednellhec vqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaald
Timeline for d1ogka_: