![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
![]() | Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
![]() | Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
![]() | Protein Chitinase B, C-terminal domain [51061] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries) |
![]() | Domain d1oggb1: 1ogg B:447-499 [92911] Other proteins in same PDB: d1ogga2, d1ogga3, d1oggb2, d1oggb3 complexed with ami, gol, naa, so4; mutant |
PDB Entry: 1ogg (more details), 1.97 Å
SCOP Domain Sequences for d1oggb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oggb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1oggb1: