Lineage for d1ogga2 (1ogg A:3-291,A:380-446)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570170Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1570229Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 1570230Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 1570259Domain d1ogga2: 1ogg A:3-291,A:380-446 [92909]
    Other proteins in same PDB: d1ogga1, d1ogga3, d1oggb1, d1oggb3
    complexed with ami, gol, so4; mutant

Details for d1ogga2

PDB Entry: 1ogg (more details), 1.97 Å

PDB Description: chitinase b from serratia marcescens mutant d142n in complex with inhibitor allosamidin
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1ogga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogga2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1ogga2:

Click to download the PDB-style file with coordinates for d1ogga2.
(The format of our PDB-style files is described here.)

Timeline for d1ogga2: