Lineage for d1ogfd_ (1ogf D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405137Fold c.133: Ribose transport protein RbsD [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 405138Superfamily c.133.1: Ribose transport protein RbsD [102546] (1 family) (S)
  5. 405139Family c.133.1.1: Ribose transport protein RbsD [102547] (1 protein)
  6. 405140Protein Ribose transport protein RbsD [102548] (1 species)
  7. 405141Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries)
  8. 405150Domain d1ogfd_: 1ogf D: [92906]

Details for d1ogfd_

PDB Entry: 1ogf (more details), 2.3 Å

PDB Description: the structure of bacillus subtilis rbsd complexed with glycerol

SCOP Domain Sequences for d1ogfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogfd_ c.133.1.1 (D:) Ribose transport protein RbsD {Bacillus subtilis}
mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
ancilqagvlf

SCOP Domain Coordinates for d1ogfd_:

Click to download the PDB-style file with coordinates for d1ogfd_.
(The format of our PDB-style files is described here.)

Timeline for d1ogfd_: