Lineage for d1ogee_ (1oge E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405137Fold c.133: Ribose transport protein RbsD [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 405138Superfamily c.133.1: Ribose transport protein RbsD [102546] (1 family) (S)
  5. 405139Family c.133.1.1: Ribose transport protein RbsD [102547] (1 protein)
  6. 405140Protein Ribose transport protein RbsD [102548] (1 species)
  7. 405141Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries)
  8. 405161Domain d1ogee_: 1oge E: [92902]
    complexed with cl, rp5

Details for d1ogee_

PDB Entry: 1oge (more details), 2.05 Å

PDB Description: the structure of bacillus subtilis rbsd complexed with ribose 5- phosphate

SCOP Domain Sequences for d1ogee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogee_ c.133.1.1 (E:) Ribose transport protein RbsD {Bacillus subtilis}
mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
ancilqagvlf

SCOP Domain Coordinates for d1ogee_:

Click to download the PDB-style file with coordinates for d1ogee_.
(The format of our PDB-style files is described here.)

Timeline for d1ogee_: