Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.133: Ribose transport protein RbsD [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
Superfamily c.133.1: Ribose transport protein RbsD [102546] (1 family) |
Family c.133.1.1: Ribose transport protein RbsD [102547] (1 protein) |
Protein Ribose transport protein RbsD [102548] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries) |
Domain d1oged_: 1oge D: [92901] |
PDB Entry: 1oge (more details), 2.05 Å
SCOP Domain Sequences for d1oged_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oged_ c.133.1.1 (D:) Ribose transport protein RbsD {Bacillus subtilis} mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy ancilqagvlf
Timeline for d1oged_:
View in 3D Domains from other chains: (mouse over for more information) d1ogea_, d1ogeb_, d1ogec_, d1ogee_ |