SCOP 1.71: Domain d1oged_: 1oge D:

Lineage for d1oged_ (1oge D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.133: Ribose transport protein RbsD [102545] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest

4. Superfamily c.133.1: Ribose transport protein RbsD [102546] (1 family)

5. Family c.133.1.1: Ribose transport protein RbsD [102547] (1 protein)

6. Protein Ribose transport protein RbsD [102548] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries)

8. Domain d1oged_: 1oge D: [92901]

Details for d1oged_

PDB Entry: 1oge, 2.05 Å

PDB Description: the structure of bacillus subtilis rbsd complexed with ribose 5- phosphate

SCOP Domain Sequences for d1oged_:

Sequence; same for both SEQRES and ATOM records:

>d1oged_ c.133.1.1 (D:) Ribose transport protein RbsD {Bacillus subtilis}
mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
ancilqagvlf

Timeline for d1oged_:

• d1oged_ first appeared in SCOP 1.67
  
• d1oged_ appears in SCOP 1.69
  
• d1oged_ appears in SCOP 1.73
  
• d1oged_ appears in the current release, SCOPe 2.08