Lineage for d1ogea_ (1oge A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923177Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2923178Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2923179Family c.133.1.1: RbsD-like [102547] (2 proteins)
    automatically mapped to Pfam PF05025
  6. 2923183Protein Ribose transport protein RbsD [102548] (1 species)
  7. 2923184Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries)
  8. 2923190Domain d1ogea_: 1oge A: [92898]
    complexed with cl, rp5

Details for d1ogea_

PDB Entry: 1oge (more details), 2.05 Å

PDB Description: the structure of bacillus subtilis rbsd complexed with ribose 5- phosphate
PDB Compounds: (A:) high affinity ribose transport protein rbsd

SCOPe Domain Sequences for d1ogea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogea_ c.133.1.1 (A:) Ribose transport protein RbsD {Bacillus subtilis [TaxId: 1423]}
mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
ancilqagvlf

SCOPe Domain Coordinates for d1ogea_:

Click to download the PDB-style file with coordinates for d1ogea_.
(The format of our PDB-style files is described here.)

Timeline for d1ogea_: