Lineage for d1ogdb_ (1ogd B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886150Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 1886151Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 1886152Family c.133.1.1: RbsD-like [102547] (2 proteins)
    automatically mapped to Pfam PF05025
  6. 1886156Protein Ribose transport protein RbsD [102548] (1 species)
  7. 1886157Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries)
  8. 1886159Domain d1ogdb_: 1ogd B: [92894]
    complexed with cl, rip

Details for d1ogdb_

PDB Entry: 1ogd (more details), 1.95 Å

PDB Description: the structure of bacillus subtilis rbsd complexed with d-ribose
PDB Compounds: (B:) high affinity ribose transport protein rbsd

SCOPe Domain Sequences for d1ogdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogdb_ c.133.1.1 (B:) Ribose transport protein RbsD {Bacillus subtilis [TaxId: 1423]}
mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
ancilqagvlf

SCOPe Domain Coordinates for d1ogdb_:

Click to download the PDB-style file with coordinates for d1ogdb_.
(The format of our PDB-style files is described here.)

Timeline for d1ogdb_: