Lineage for d1ogce_ (1ogc E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923177Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2923178Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2923179Family c.133.1.1: RbsD-like [102547] (2 proteins)
    automatically mapped to Pfam PF05025
  6. 2923183Protein Ribose transport protein RbsD [102548] (1 species)
  7. 2923184Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries)
  8. 2923199Domain d1ogce_: 1ogc E: [92892]
    complexed with cl

Details for d1ogce_

PDB Entry: 1ogc (more details), 2 Å

PDB Description: the structure of bacillus subtilis rbsd complexed with d-ribose
PDB Compounds: (E:) high affinity ribose transport protein rbsd

SCOPe Domain Sequences for d1ogce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogce_ c.133.1.1 (E:) Ribose transport protein RbsD {Bacillus subtilis [TaxId: 1423]}
mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
ancilqagvlf

SCOPe Domain Coordinates for d1ogce_:

Click to download the PDB-style file with coordinates for d1ogce_.
(The format of our PDB-style files is described here.)

Timeline for d1ogce_: