![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.133: Ribose transport protein RbsD [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
![]() | Superfamily c.133.1: Ribose transport protein RbsD [102546] (1 family) ![]() |
![]() | Family c.133.1.1: Ribose transport protein RbsD [102547] (1 protein) |
![]() | Protein Ribose transport protein RbsD [102548] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries) |
![]() | Domain d1ogcb_: 1ogc B: [92889] |
PDB Entry: 1ogc (more details), 2 Å
SCOP Domain Sequences for d1ogcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogcb_ c.133.1.1 (B:) Ribose transport protein RbsD {Bacillus subtilis} mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy ancilqagvlf
Timeline for d1ogcb_:
![]() Domains from other chains: (mouse over for more information) d1ogca_, d1ogcc_, d1ogcd_, d1ogce_ |