| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Chitinase B [54560] (1 species) |
| Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries) |
| Domain d1ogbb3: 1ogb B:292-379 [92887] Other proteins in same PDB: d1ogba1, d1ogba2, d1ogbb1, d1ogbb2 |
PDB Entry: 1ogb (more details), 1.85 Å
SCOP Domain Sequences for d1ogbb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogbb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty
Timeline for d1ogbb3: