Lineage for d1ogbb3 (1ogb B:292-379)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 502014Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 502015Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 502042Protein Chitinase B [54560] (1 species)
  7. 502043Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)
  8. 502051Domain d1ogbb3: 1ogb B:292-379 [92887]
    Other proteins in same PDB: d1ogba1, d1ogba2, d1ogbb1, d1ogbb2

Details for d1ogbb3

PDB Entry: 1ogb (more details), 1.85 Å

PDB Description: chitinase b from serratia marcescens mutant d142n

SCOP Domain Sequences for d1ogbb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogbb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1ogbb3:

Click to download the PDB-style file with coordinates for d1ogbb3.
(The format of our PDB-style files is described here.)

Timeline for d1ogbb3: