SCOPe 2.08: Domain d1ogbb3: 1ogb B:292-379

Lineage for d1ogbb3 (1ogb B:292-379)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)

8. Domain d1ogbb3: 1ogb B:292-379 [92887]
   Other proteins in same PDB: d1ogba1, d1ogba2, d1ogbb1, d1ogbb2
   complexed with gol, so4; mutant

Details for d1ogbb3

PDB Entry: 1ogb, 1.85 Å

PDB Description: chitinase b from serratia marcescens mutant d142n

PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1ogbb3:

Sequence; same for both SEQRES and ATOM records:

>d1ogbb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1ogbb3:

• d1ogbb3 first appeared in SCOP 1.67
  
• d1ogbb3 appears in SCOPe 2.07