SCOPe 2.08: Domain d1ofwb_: 1ofw B:

Lineage for d1ofwb_ (1ofw B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Nine-heme cytochrome c [48705] (2 species)
   tandem repeat of two cytochrome c3-like domains with additional heme-binding site in the domain interface

7. Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48706] (3 PDB entries)

8. Domain d1ofwb_: 1ofw B: [92851]
   complexed with act, gol, hec
   multiple common domains: applies to families that are inconsistently divided into domains

Details for d1ofwb_

PDB Entry: 1ofw, 1.5 Å

PDB Description: three dimensional structure of the oxidized form of nine heme cytochrome c at ph 7.5

PDB Compounds: (B:) nine-heme cytochrome c

SCOPe Domain Sequences for d1ofwb_:

Sequence; same for both SEQRES and ATOM records:

>d1ofwb_ a.138.1.1 (B:) Nine-heme cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}
aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkidncetchhtgdpvscs
tchtvegkaegnyitldramhatniakrakgntpvscvscheqqtkerrecagchaivtp
krdeawcatchnitpsmtpeqmqkgingtllpgdnealaaetvlaqktvepvspmlapyk
vvidaladkyepsnfthrrhltslmerikddklaqafhnkpeilcatchhrsplsltppk
cgschtkeidkanpgrpnlmaayhlqcmgchkgmdvarprdtdcttchkaapk

Timeline for d1ofwb_:

• d1ofwb_ first appeared in SCOP 1.67
  
• d1ofwb_ appears in SCOPe 2.07