Class a: All alpha proteins [46456] (290 folds) |
Fold a.187: HAND domain of the nucleosome remodeling ATPase ISWI [101223] (1 superfamily) 4 helices; irregular array |
Superfamily a.187.1: HAND domain of the nucleosome remodeling ATPase ISWI [101224] (2 families) automatically mapped to Pfam PF09110 |
Family a.187.1.1: HAND domain of the nucleosome remodeling ATPase ISWI [101225] (1 protein) |
Protein HAND domain of the nucleosome remodeling ATPase ISWI [101226] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101227] (1 PDB entry) |
Domain d1ofcx3: 1ofc X:697-798 [92828] Other proteins in same PDB: d1ofcx1, d1ofcx2 complexed with g4d, glc, gol |
PDB Entry: 1ofc (more details), 1.9 Å
SCOPe Domain Sequences for d1ofcx3:
Sequence, based on SEQRES records: (download)
>d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} avdayfrealrvsepkapkaprppkqpivqdfqffpprlfelldqeiyyfrktvgykvpk ntelgsdatkvqreeqrkideaeplteeeiqekenllsqgft
>d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} avdayfrealkaprppkqpivqdfqffpprlfelldqeiyyfrktvgykvpkntkvqree qrkideaeplteeeiqekenllsqgft
Timeline for d1ofcx3: