Lineage for d1ofcx3 (1ofc X:697-798)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736185Fold a.187: HAND domain of the nucleosome remodeling ATPase ISWI [101223] (1 superfamily)
    4 helices; irregular array
  4. 2736186Superfamily a.187.1: HAND domain of the nucleosome remodeling ATPase ISWI [101224] (2 families) (S)
    automatically mapped to Pfam PF09110
  5. 2736187Family a.187.1.1: HAND domain of the nucleosome remodeling ATPase ISWI [101225] (1 protein)
  6. 2736188Protein HAND domain of the nucleosome remodeling ATPase ISWI [101226] (1 species)
  7. 2736189Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101227] (1 PDB entry)
  8. 2736190Domain d1ofcx3: 1ofc X:697-798 [92828]
    Other proteins in same PDB: d1ofcx1, d1ofcx2
    complexed with g4d, glc, gol

Details for d1ofcx3

PDB Entry: 1ofc (more details), 1.9 Å

PDB Description: nucleosome recognition module of iswi atpase
PDB Compounds: (X:) iswi protein

SCOPe Domain Sequences for d1ofcx3:

Sequence, based on SEQRES records: (download)

>d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
avdayfrealrvsepkapkaprppkqpivqdfqffpprlfelldqeiyyfrktvgykvpk
ntelgsdatkvqreeqrkideaeplteeeiqekenllsqgft

Sequence, based on observed residues (ATOM records): (download)

>d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
avdayfrealkaprppkqpivqdfqffpprlfelldqeiyyfrktvgykvpkntkvqree
qrkideaeplteeeiqekenllsqgft

SCOPe Domain Coordinates for d1ofcx3:

Click to download the PDB-style file with coordinates for d1ofcx3.
(The format of our PDB-style files is described here.)

Timeline for d1ofcx3: