Lineage for d1ofaa_ (1ofa A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086073Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 2086074Species Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId:4932] [82272] (11 PDB entries)
  8. 2086091Domain d1ofaa_: 1ofa A: [92822]
    complexed with co, gol, pep

Details for d1ofaa_

PDB Entry: 1ofa (more details), 2.01 Å

PDB Description: Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with phosphoenolpyruvate and cobalt(ii)
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d1ofaa_:

Sequence, based on SEQRES records: (download)

>d1ofaa_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]}
vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnk

Sequence, based on observed residues (ATOM records): (download)

>d1ofaa_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]}
vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
nqgipaglkygvsitdacigwettedvlrklaaavrqrrevnk

SCOPe Domain Coordinates for d1ofaa_:

Click to download the PDB-style file with coordinates for d1ofaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ofaa_: