Lineage for d1of2a1 (1of2 A:182-276)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364635Domain d1of2a1: 1of2 A:182-276 [92808]
    Other proteins in same PDB: d1of2a2, d1of2b_
    complexed with gol, mn

Details for d1of2a1

PDB Entry: 1of2 (more details), 2.2 Å

PDB Description: crystal structure of hla-b*2709 complexed with the vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)

SCOP Domain Sequences for d1of2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1of2a1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1of2a1:

Click to download the PDB-style file with coordinates for d1of2a1.
(The format of our PDB-style files is described here.)

Timeline for d1of2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1of2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1of2b_