![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) [102792] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102793] (1 PDB entry) |
![]() | Domain d1oeyl_: 1oey L: [92806] Other proteins in same PDB: d1oeya_, d1oeyb_, d1oeyc_, d1oeyd_ |
PDB Entry: 1oey (more details), 2 Å
SCOPe Domain Sequences for d1oeyl_:
Sequence, based on SEQRES records: (download)
>d1oeyl_ d.15.2.2 (L:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv rllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
>d1oeyl_ d.15.2.2 (L:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv rllsdedvalmvrqargrlfpwklhitqkdnyrvyntmp
Timeline for d1oeyl_: