SCOP 1.67: Domain d1oeyl_: 1oey L:

Lineage for d1oeyl_ (1oey L:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (4 proteins)
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) [102792] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102793] (1 PDB entry)

8. Domain d1oeyl_: 1oey L: [92806]
   Other proteins in same PDB: d1oeya_, d1oeyb_, d1oeyc_, d1oeyd_

Details for d1oeyl_

PDB Entry: 1oey, 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase

SCOP Domain Sequences for d1oeyl_:

Sequence, based on SEQRES records:

>d1oeyl_ d.15.2.2 (L:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens)}
mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
rllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp

Sequence, based on observed residues (ATOM records):

>d1oeyl_ d.15.2.2 (L:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens)}
mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
rllsdedvalmvrqargrlfpwklhitqkdnyrvyntmp

Timeline for d1oeyl_:

• d1oeyl_ is new in SCOP 1.67
  
• d1oeyl_ appears in SCOP 1.69
  
• d1oeyl_ appears in the current release, SCOPe 2.08