Lineage for d1oeyj_ (1oey J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1893877Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1893893Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1893926Protein Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) [102792] (1 species)
  7. 1893927Species Human (Homo sapiens) [TaxId:9606] [102793] (1 PDB entry)
  8. 1893928Domain d1oeyj_: 1oey J: [92804]
    Other proteins in same PDB: d1oeya_, d1oeyb_, d1oeyc_, d1oeyd_

Details for d1oeyj_

PDB Entry: 1oey (more details), 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
PDB Compounds: (J:) neutrophil cytosol factor 4

SCOPe Domain Sequences for d1oeyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeyj_ d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]}
hmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdl
vrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp

SCOPe Domain Coordinates for d1oeyj_:

Click to download the PDB-style file with coordinates for d1oeyj_.
(The format of our PDB-style files is described here.)

Timeline for d1oeyj_: