SCOP 1.69: Domain d1oeyb_: 1oey B:

Lineage for d1oeyb_ (1oey B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (5 proteins)
   Pfam 00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) [102790] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102791] (1 PDB entry)

8. Domain d1oeyb_: 1oey B: [92801]
   Other proteins in same PDB: d1oeyj_, d1oeyk_, d1oeyl_, d1oeym_

Details for d1oeyb_

PDB Entry: 1oey, 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase

SCOP Domain Sequences for d1oeyb_:

Sequence; same for both SEQRES and ATOM records:

>d1oeyb_ d.15.2.2 (B:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens)}
aytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsm
kdawgqvknycltlwce

Timeline for d1oeyb_:

• d1oeyb_ first appeared in SCOP 1.67
  
• d1oeyb_ appears in SCOP 1.71
  
• d1oeyb_ appears in the current release, SCOPe 2.08, called d1oeyb1