SCOPe 2.05: Domain d1oeka_: 1oek A:

Lineage for d1oeka_ (1oek A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
   bacterial metal-binding, lipocalin-like protein
   automatically mapped to Pfam PF09223

6. Protein Hypothetical protein YodA [101864] (2 species)

7. Species Escherichia coli [TaxId:562] [101865] (5 PDB entries)
   Uniprot P76344

8. Domain d1oeka_: 1oek A: [92799]
   complexed with zn

Details for d1oeka_

PDB Entry: 1oek, 2.4 Å

PDB Description: yoda from escherichia coli crystallised with zinc ions

PDB Compounds: (A:) hypothetical protein yoda

SCOPe Domain Sequences for d1oeka_:

Sequence; same for both SEQRES and ATOM records:

>d1oeka_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
plteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktktfa
eikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylfec
kdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseevve
emmsh

Timeline for d1oeka_:

• d1oeka_ first appeared in SCOP 1.67
  
• d1oeka_ appears in SCOPe 2.04
  
• d1oeka_ appears in SCOPe 2.06
  
• d1oeka_ appears in the current release, SCOPe 2.08