Lineage for d1oeja_ (1oej A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2415004Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2415005Protein Hypothetical protein YodA [101864] (3 species)
  7. 2415008Species Escherichia coli [TaxId:562] [101865] (6 PDB entries)
    Uniprot P76344
  8. 2415009Domain d1oeja_: 1oej A: [92798]
    complexed with ni

Details for d1oeja_

PDB Entry: 1oej (more details), 1.81 Å

PDB Description: yoda from escherichia coli crystallised with no added ions
PDB Compounds: (A:) hypothetical protein yoda

SCOPe Domain Sequences for d1oeja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeja_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

SCOPe Domain Coordinates for d1oeja_:

Click to download the PDB-style file with coordinates for d1oeja_.
(The format of our PDB-style files is described here.)

Timeline for d1oeja_: