Lineage for d1oeea_ (1oee A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800625Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 1800626Protein Hypothetical protein YodA [101864] (2 species)
  7. 1800629Species Escherichia coli [TaxId:562] [101865] (5 PDB entries)
    Uniprot P76344
  8. 1800632Domain d1oeea_: 1oee A: [92795]
    complexed with cd

Details for d1oeea_

PDB Entry: 1oee (more details), 2.1 Å

PDB Description: yoda from escherichia coli crystallised with cadmium ions
PDB Compounds: (A:) hypothetical protein yoda

SCOPe Domain Sequences for d1oeea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeea_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
plteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktktfa
eikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylfec
kdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseevve
emmsh

SCOPe Domain Coordinates for d1oeea_:

Click to download the PDB-style file with coordinates for d1oeea_.
(The format of our PDB-style files is described here.)

Timeline for d1oeea_: