Lineage for d1oeea_ (1oee A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378568Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 378569Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 378902Family b.60.1.4: Hypothetical protein YodA [101863] (1 protein)
    bacterial metal-binding, lipocalin-like protein
  6. 378903Protein Hypothetical protein YodA [101864] (1 species)
  7. 378904Species Escherichia coli [TaxId:562] [101865] (3 PDB entries)
  8. 378906Domain d1oeea_: 1oee A: [92795]
    complexed with cd

Details for d1oeea_

PDB Entry: 1oee (more details), 2.1 Å

PDB Description: yoda from escherichia coli crystallised with cadmium ions

SCOP Domain Sequences for d1oeea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeea_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli}
plteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktktfa
eikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylfec
kdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseevve
emmsh

SCOP Domain Coordinates for d1oeea_:

Click to download the PDB-style file with coordinates for d1oeea_.
(The format of our PDB-style files is described here.)

Timeline for d1oeea_: