Lineage for d1oe9b_ (1oe9 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537713Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 537894Protein Myosin Essential Chain [47524] (3 species)
  7. 537920Species Human (Homo sapiens) [TaxId:9606] [101181] (1 PDB entry)
  8. 537921Domain d1oe9b_: 1oe9 B: [92794]
    Other proteins in same PDB: d1oe9a1, d1oe9a2
    complexed with so4

Details for d1oe9b_

PDB Entry: 1oe9 (more details), 2.05 Å

PDB Description: crystal structure of myosin v motor with essential light chain - nucleotide-free

SCOP Domain Sequences for d1oe9b_:

Sequence, based on SEQRES records: (download)

>d1oe9b_ a.39.1.5 (B:) Myosin Essential Chain {Human (Homo sapiens)}
fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr
rvdfetflpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmtee
evetvlaghedsngcinyeaflkhils

Sequence, based on observed residues (ATOM records): (download)

>d1oe9b_ a.39.1.5 (B:) Myosin Essential Chain {Human (Homo sapiens)}
fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr
rvdfetflpmlqavakyedylegfrvfdgngkvmgaelrhvlttlgekmteeevetvlag
hedsngcinyeaflkhils

SCOP Domain Coordinates for d1oe9b_:

Click to download the PDB-style file with coordinates for d1oe9b_.
(The format of our PDB-style files is described here.)

Timeline for d1oe9b_: