Lineage for d1oe9a2 (1oe9 A:63-795)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111682Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [102369] (2 PDB entries)
  8. 2111684Domain d1oe9a2: 1oe9 A:63-795 [92793]
    Other proteins in same PDB: d1oe9a1, d1oe9b_
    complexed with so4

Details for d1oe9a2

PDB Entry: 1oe9 (more details), 2.05 Å

PDB Description: crystal structure of myosin v motor with essential light chain - nucleotide-free
PDB Compounds: (A:) myosin va

SCOPe Domain Sequences for d1oe9a2:

Sequence, based on SEQRES records: (download)

>d1oe9a2 c.37.1.9 (A:63-795) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekaisp
tsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvrci
kpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvls
drkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirgwl
mrkkymrmrrgda

Sequence, based on observed residues (ATOM records): (download)

>d1oe9a2 c.37.1.9 (A:63-795) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsnveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksr
vvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakemvnt
rqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmgvdy
eemahwlchrklatyikpisklhainardalakhiyanlfnwivdhvnkalhstvkqhsf
igvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipdfydnqpci
nlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafiikhfadk
veyqcegfleknkdtvyeeqikvlksskkfkllpelfhkktvghqfrnslhllmetlnat
tphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvl
mkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciri
qktirgwlmrkkymrmrrgda

SCOPe Domain Coordinates for d1oe9a2:

Click to download the PDB-style file with coordinates for d1oe9a2.
(The format of our PDB-style files is described here.)

Timeline for d1oe9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oe9a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1oe9b_