Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (3 PDB entries) |
Domain d1oe9a1: 1oe9 A:5-62 [92792] Other proteins in same PDB: d1oe9a2, d1oe9b_ complexed with so4 |
PDB Entry: 1oe9 (more details), 2.05 Å
SCOPe Domain Sequences for d1oe9a1:
Sequence, based on SEQRES records: (download)
>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl
>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleyclkelppl
Timeline for d1oe9a1: