![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) ![]() |
![]() | Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
![]() | Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
![]() | Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (1 PDB entry) |
![]() | Domain d1oe9a1: 1oe9 A:5-62 [92792] Other proteins in same PDB: d1oe9a2, d1oe9b_ complexed with so4 |
PDB Entry: 1oe9 (more details), 2.05 Å
SCOP Domain Sequences for d1oe9a1:
Sequence, based on SEQRES records: (download)
>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform} elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl
>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform} elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleyclkelppl
Timeline for d1oe9a1: