Lineage for d1oe9a1 (1oe9 A:5-62)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783669Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2783670Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2783671Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2783701Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (2 PDB entries)
  8. 2783703Domain d1oe9a1: 1oe9 A:5-62 [92792]
    Other proteins in same PDB: d1oe9a2, d1oe9b_
    complexed with so4

Details for d1oe9a1

PDB Entry: 1oe9 (more details), 2.05 Å

PDB Description: crystal structure of myosin v motor with essential light chain - nucleotide-free
PDB Compounds: (A:) myosin va

SCOPe Domain Sequences for d1oe9a1:

Sequence, based on SEQRES records: (download)

>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl

Sequence, based on observed residues (ATOM records): (download)

>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleyclkelppl

SCOPe Domain Coordinates for d1oe9a1:

Click to download the PDB-style file with coordinates for d1oe9a1.
(The format of our PDB-style files is described here.)

Timeline for d1oe9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oe9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1oe9b_