SCOPe 2.05: Domain d1oe0b_: 1oe0 B:

Lineage for d1oe0b_ (1oe0 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Deoxyribonucleoside kinase [69478] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)

8. Domain d1oe0b_: 1oe0 B: [92789]
   complexed with mg, ttp

Details for d1oe0b_

PDB Entry: 1oe0, 2.4 Å

PDB Description: crystal structure of drosophila deoxyribonucleoside kinase in complex with dttp

PDB Compounds: (B:) Deoxyribonucleoside kinase

SCOPe Domain Sequences for d1oe0b_:

Sequence; same for both SEQRES and ATOM records:

>d1oe0b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldadln

Timeline for d1oe0b_:

• d1oe0b_ first appeared in SCOP 1.67
  
• d1oe0b_ appears in SCOPe 2.04
  
• d1oe0b_ appears in SCOPe 2.06
  
• d1oe0b_ appears in the current release, SCOPe 2.08