Lineage for d1odua2 (1odu A:7-356)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083606Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 protein domains)
    glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
    automatically mapped to Pfam PF01120
  6. 2083607Protein Putative alpha-L-fucosidase, catalytic domain [102080] (1 species)
  7. 2083608Species Thermotoga maritima [TaxId:2336] [102081] (3 PDB entries)
    TM0306
  8. 2083613Domain d1odua2: 1odu A:7-356 [92785]
    Other proteins in same PDB: d1odua1, d1odub1
    complexed with ful

Details for d1odua2

PDB Entry: 1odu (more details), 2.8 Å

PDB Description: crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
PDB Compounds: (A:) putative alpha-l-fucosidase

SCOPe Domain Sequences for d1odua2:

Sequence, based on SEQRES records: (download)

>d1odua2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

Sequence, based on observed residues (ATOM records): (download)

>d1odua2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatpdawffqnpyaewyenslrik
esptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvipttkhhdgfclw
gtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepirypedlsyir
pntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkhpegsvndrw
gvphwdfktaedlpgykweftrgiglsfgynrnehmlsveqlvytlvdvvskggnlllnv
gpkgdgtipdlqkerllglgewlrkygdaiy

SCOPe Domain Coordinates for d1odua2:

Click to download the PDB-style file with coordinates for d1odua2.
(The format of our PDB-style files is described here.)

Timeline for d1odua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1odua1