Lineage for d1odoa_ (1odo A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359341Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 359342Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 359343Family a.104.1.1: Cytochrome P450 [48265] (19 proteins)
  6. 359360Protein Cyp154a1 monooxygenase [101373] (1 species)
  7. 359361Species Streptomyces coelicolor [TaxId:1902] [101374] (1 PDB entry)
  8. 359362Domain d1odoa_: 1odo A: [92783]
    complexed with hem, pim

Details for d1odoa_

PDB Entry: 1odo (more details), 1.85 Å

PDB Description: 1.85 a structure of cyp154a1 from streptomyces coelicolor a3(2)

SCOP Domain Sequences for d1odoa_:

Sequence, based on SEQRES records: (download)

>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor}
alvldptgadhhtehrtlreggpatwvdvlgvqawsvsdpvllkqlltssdvskdarahw
pafgevvgtwplalwvavenmftaygpnhrklrrlvapafsarrvdamrpaveamvtglv
drlaelpagepvdlrqelayplpiavighlmgvpqdrrdgfralvdgvfdttldqaeaqa
ntarlyevldqliaakratpgddmtslliaarddegdgdrlspeelrdtlllmisagyet
tvnvidqavhtlltrpdqlalvrkgevtwadvveetlrhepavkhlplryavtdialpdg
rtiargepilasyaaanrhpdwhedadtfdatrtvkehlafghgvhfclgaplarmevtl
aleslfgrfpdlrladpaeelppvpslisnghqrlpvllha

Sequence, based on observed residues (ATOM records): (download)

>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor}
alvldptgadhhtehrtlreggpatwvdvlgvqawsvsdpvllkqlltssdvskdarahw
pafgevvgtwplalwvavenmftaygpnhrklrrlvapafsarrvdamrpaveamvtglv
drlaelpagepvdlrqelayplpiavighlmgvpqdrrdgfralvdgvfdttldqaeaqa
ntarlyevldqliaakratpgddmtslliaarddrlspeelrdtlllmisagyettvnvi
dqavhtlltrpdqlalvrkgevtwadvveetlrhepavkhlplryavtdialpdgrtiar
gepilasyaaanrhpdwhedadtfdatrtvkehlafghgvhfclgaplarmevtlalesl
fgrfpdlrladpaeelppvpslisnghqrlpvllha

SCOP Domain Coordinates for d1odoa_:

Click to download the PDB-style file with coordinates for d1odoa_.
(The format of our PDB-style files is described here.)

Timeline for d1odoa_: