Lineage for d1odoa_ (1odo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004995Protein Cyp154a1 monooxygenase [101373] (1 species)
  7. 2004996Species Streptomyces coelicolor [TaxId:1902] [101374] (1 PDB entry)
  8. 2004997Domain d1odoa_: 1odo A: [92783]
    complexed with hem, pim

Details for d1odoa_

PDB Entry: 1odo (more details), 1.85 Å

PDB Description: 1.85 a structure of cyp154a1 from streptomyces coelicolor a3(2)
PDB Compounds: (A:) putative cytochrome p450 154a1

SCOPe Domain Sequences for d1odoa_:

Sequence, based on SEQRES records: (download)

>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]}
alvldptgadhhtehrtlreggpatwvdvlgvqawsvsdpvllkqlltssdvskdarahw
pafgevvgtwplalwvavenmftaygpnhrklrrlvapafsarrvdamrpaveamvtglv
drlaelpagepvdlrqelayplpiavighlmgvpqdrrdgfralvdgvfdttldqaeaqa
ntarlyevldqliaakratpgddmtslliaarddegdgdrlspeelrdtlllmisagyet
tvnvidqavhtlltrpdqlalvrkgevtwadvveetlrhepavkhlplryavtdialpdg
rtiargepilasyaaanrhpdwhedadtfdatrtvkehlafghgvhfclgaplarmevtl
aleslfgrfpdlrladpaeelppvpslisnghqrlpvllha

Sequence, based on observed residues (ATOM records): (download)

>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]}
alvldptgadhhtehrtlreggpatwvdvlgvqawsvsdpvllkqlltssdvskdarahw
pafgevvgtwplalwvavenmftaygpnhrklrrlvapafsarrvdamrpaveamvtglv
drlaelpagepvdlrqelayplpiavighlmgvpqdrrdgfralvdgvfdttldqaeaqa
ntarlyevldqliaakratpgddmtslliaarddrlspeelrdtlllmisagyettvnvi
dqavhtlltrpdqlalvrkgevtwadvveetlrhepavkhlplryavtdialpdgrtiar
gepilasyaaanrhpdwhedadtfdatrtvkehlafghgvhfclgaplarmevtlalesl
fgrfpdlrladpaeelppvpslisnghqrlpvllha

SCOPe Domain Coordinates for d1odoa_:

Click to download the PDB-style file with coordinates for d1odoa_.
(The format of our PDB-style files is described here.)

Timeline for d1odoa_: