![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins) |
![]() | Protein Hypothetical protein Ygr205W [102356] (1 species) close structural similarity to PanK |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102357] (1 PDB entry) |
![]() | Domain d1odfa_: 1odf A: [92782] complexed with gol, so4 |
PDB Entry: 1odf (more details), 2.25 Å
SCOP Domain Sequences for d1odfa_:
Sequence, based on SEQRES records: (download)
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae)} sktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyggeks igyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnnnehpdqd tvvlpkydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltgdmvd vnaklffysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeqvhaf vdrympsyklylndfvrseslgsiatltlgidsnrnvystktrcie
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae)} sktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyggeks igyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnqdtvvlpk ydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltgdmvdvnaklf fysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeqvhafvdrymp syklylndfvrseslgsiatltlgidsnrnvystktrcie
Timeline for d1odfa_: