Lineage for d1odfa_ (1odf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110026Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 protein domains)
  6. 2110030Protein Hypothetical protein Ygr205W [102356] (1 species)
    close structural similarity to PanK
  7. 2110031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102357] (1 PDB entry)
  8. 2110032Domain d1odfa_: 1odf A: [92782]
    complexed with gol, so4

Details for d1odfa_

PDB Entry: 1odf (more details), 2.25 Å

PDB Description: structure of ygr205w protein.
PDB Compounds: (A:) hypothetical 33.3 kda protein in ade3-ser2 intergenic region

SCOPe Domain Sequences for d1odfa_:

Sequence, based on SEQRES records: (download)

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyggeks
igyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnnnehpdqd
tvvlpkydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltgdmvd
vnaklffysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeqvhaf
vdrympsyklylndfvrseslgsiatltlgidsnrnvystktrcie

Sequence, based on observed residues (ATOM records): (download)

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyggeks
igyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnqdtvvlpk
ydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltgdmvdvnaklf
fysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeqvhafvdrymp
syklylndfvrseslgsiatltlgidsnrnvystktrcie

SCOPe Domain Coordinates for d1odfa_:

Click to download the PDB-style file with coordinates for d1odfa_.
(The format of our PDB-style files is described here.)

Timeline for d1odfa_: